DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and pepP

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_417384.1 Gene:pepP / 947385 ECOCYCID:EG10697 Length:441 Species:Escherichia coli


Alignment Length:163 Identity:32/163 - (19%)
Similarity:60/163 - (36%) Gaps:56/163 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 RSSATTSVLHNRKRNSC---------WGRAHSFLTRNWYLGCLVPA--TILGA------------ 136
            |:...|::.|.|....|         .|..|....|:   |...|:  ||:|:            
E. coli   187 RAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRH---GARYPSYNTIVGSGENGCILHYTEN 248

  Fly   137 --------LVFI-------GWA---TRDY--------ARQLLFWIEMQNAWITFAVYMGLFALVS 175
                    ||.|       |:|   ||.:        |::.::.|.:::...:..:|....:::.
E. coli   249 ECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILE 313

  Fly   176 FPVVVGYFVLLITAGYL-FGCLRGWVTVILGAN 207
               |.|..|.::.:|.: .|.|:|.|..::..|
E. coli   314 ---VTGEVVRIMVSGLVKLGILKGDVDELIAQN 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 11/59 (19%)
SNARE_assoc 180..298 CDD:286425 8/29 (28%)
pepPNP_417384.1 PRK10879 4..441 CDD:182804 32/163 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.