DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11367 and ypdF

DIOPT Version :9

Sequence 1:	NP_649412.1	Gene:	CG11367 / 40491	FlyBaseID:	FBgn0037185	Length:	362	Species:	Drosophila melanogaster
Sequence 2:	NP_416886.1	Gene:	ypdF / 946853	ECOCYCID:	G7248	Length:	361	Species:	Escherichia coli

Alignment Length:	58	Identity:	13/58 - (22%)
Similarity:	26/58 - (44%)	Gaps:	15/58 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly   303 MHEVLSDNDTKLTGYISFLFEVICGVALMFWVLQKARKELSETLLSADYNNEGKHPDV 360
            ::::::|...:..|     ||   |..:.:....:.:.||:..|:||.       |||
E. coli    81 VNQIIADEQLQTLG-----FE---GQQVSWETAHRWQSELNAKLVSAT-------PDV 123

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11367	NP_649412.1	DedA	150..340	CDD:223659	5/36 (14%)
CG11367	NP_649412.1	SNARE_assoc	180..298	CDD:286425
ypdF	NP_416886.1	PRK09795	1..361	CDD:182080	13/58 (22%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0006
Hieranoid	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
	1	0.900