DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and ydjZ

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_416266.1 Gene:ydjZ / 946269 ECOCYCID:G6947 Length:235 Species:Escherichia coli


Alignment Length:255 Identity:59/255 - (23%)
Similarity:99/255 - (38%) Gaps:69/255 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 WY----LGCLVPATIL------GALVFIGWATRDYARQLLFWIEMQNAWITFAVYMGLFALVSFP 177
            ||    |..|:.|.:|      |...||..:...:|.     ::.|........|..|.|:|||.
E. coli    10 WYYRITLIILLFAMLLAWALLPGVHEFINRSVAAFAA-----VDQQGIERFIQSYGALAAVVSFL 69

  Fly   178 VVV--------GYFVLLITAGYLFGCLRG----WVTVILGANIGIAVAHATIRSCRHRIPVQRLI 230
            :::        ..|::......|||...|    |.:.:.||.:...:|         |:..:.::
E. coli    70 LMILQAIAAPLPAFLITFANASLFGAFWGGLLSWTSSMAGAALCFFIA---------RVMGREVV 125

  Fly   231 KNDTGRAILRVISGPKAF------RVVLFTRLTP-IPFGVQNVIFGISSINTRDYHVATLIGLLP 288
            :..||:.:|..:.|   |      ..:|..||.| :||...:...|::||..|.:.:||.:|.||
E. coli   126 EKLTGKTVLDSMDG---FFTRYGKHTILVCRLLPFVPFDPISYAAGLTSIRFRSFFIATGLGQLP 187

  Fly   289 AQTINVYLGSTLRSMHEVLSDNDTKLTG---------YISFLFEVICGVALMFWVLQKAR 339
            |..:..:.||              .|||         :|.|...|:..:|...|:.::.|
E. coli   188 ATIVYSWAGS--------------MLTGGTFWFVTGLFILFALTVVIFMAKKIWLERQKR 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 49/218 (22%)
SNARE_assoc 180..298 CDD:286425 31/136 (23%)
ydjZNP_416266.1 TVP38 15..235 CDD:223475 57/250 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003179
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.