DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and ydjX

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_416264.4 Gene:ydjX / 946250 ECOCYCID:G6945 Length:236 Species:Escherichia coli


Alignment Length:243 Identity:55/243 - (22%)
Similarity:112/243 - (46%) Gaps:20/243 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 RNWYLGCLVPATILGALVFIGWATRDYARQL--LFWIEMQNAWITFAVYMGLFALVSFPVVVGYF 183
            |.:...||:.|.::.|:...|  ..|....|  |..:..|:.:..:::|:.||.:.:..::.| .
E. coli     5 RKFLFACLIFALVIYAIHAFG--LFDLLTDLPHLQTLIRQSGFFGYSLYILLFIIATLLLLPG-S 66

  Fly   184 VLLITAGYLFGCLRGWVTVILGANIGIAVAHATIRSCRHRIPVQRLIKNDTGRAILRVISGPKAF 248
            :|:|..|.:||.|.|.:..::.|.:..:.:....|.....:.::.:..::|.:||.:.|: ....
E. coli    67 ILVIAGGIVFGPLLGTLLSLIAATLASSCSFLLARWLGRDLLLKYVGHSNTFQAIEKGIA-RNGI 130

  Fly   249 RVVLFTRLTPI-PFGVQNVIFGISSINTRDYHVATLIGLLPAQTINVYLGSTLRSMHEVLSDNDT 312
            ..::.|||.|: |:.:||..:|:::|....|.:.:.:..||...|...:.|.|  .:|.::    
E. coli   131 DFLILTRLIPLFPYNIQNYAYGLTTIAFWPYTLISALTTLPGIVIYTVMASDL--ANEGIT---- 189

  Fly   313 KLTGYISFLFEV-ICGVALMFWV-LQKARKELSETLLSADYNNEGKHP 358
                 :.|:.:: :.|:||...| |.|.........|||...:...||
E. coli   190 -----LRFILQLCLAGLALFILVQLAKLYARHKHVDLSASRRSPLTHP 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 43/194 (22%)
SNARE_assoc 180..298 CDD:286425 27/118 (23%)
ydjXNP_416264.4 TVP38 1..221 CDD:223475 50/230 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003179
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.