DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and TMEM41A

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_542383.1 Gene:TMEM41A / 90407 HGNCID:30544 Length:264 Species:Homo sapiens


Alignment Length:226 Identity:46/226 - (20%)
Similarity:88/226 - (38%) Gaps:40/226 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 RDYARQLLFWIEMQNAWITFAVYMGLFALVSFPVVVGYFVLLITAGYLFGCLRGWVTVILGANIG 209
            |:|.::       ..|:: |.::.|.:.......:.|...|.:.||.|||...|.:...:..::|
Human    59 REYRKE-------HQAYV-FLLFCGAYLYKQGFAIPGSSFLNVLAGALFGPWLGLLLCCVLTSVG 115

  Fly   210 IAVAHATIRSCRHRIPV----------QRLIKNDTGRAILRVISGPKAFRVVLFTRLTPI-PFGV 263
            ....:........::.|          ||.::.:..          ..|..:||.||.|: |...
Human   116 ATCCYLLSSIFGKQLVVSYFPDKVALLQRKVEENRN----------SLFFFLLFLRLFPMTPNWF 170

  Fly   264 QNVIFGISSINTRDYHVATLIGLLPAQTINVYLGSTLRSMHEVLSDNDTKLTGYISF--LFEVIC 326
            .|:...|.:|....:..:.||||:|...|.|..||.|.::        |.|....|:  :|::: 
Human   171 LNLSAPILNIPIVQFFFSVLIGLIPYNFICVQTGSILSTL--------TSLDALFSWDTVFKLL- 226

  Fly   327 GVALMFWVLQKARKELSETLLSADYNNEGKH 357
            .:|::..:.....|:.|:..|..:..:...|
Human   227 AIAMVALIPGTLIKKFSQKHLQLNETSTANH 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 40/202 (20%)
SNARE_assoc 180..298 CDD:286425 29/128 (23%)
TMEM41ANP_542383.1 VTT 85..205 CDD:378149 29/129 (22%)
VTT domain. /evidence=ECO:0000305|PubMed:30093494 96..207 28/120 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.