DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and AT1G71940

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001185376.1 Gene:AT1G71940 / 843525 AraportID:AT1G71940 Length:306 Species:Arabidopsis thaliana


Alignment Length:246 Identity:65/246 - (26%)
Similarity:89/246 - (36%) Gaps:76/246 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 SCWGRAHS---FLTRNWYLGCL---VPATILGALVF-------------IGWATRDYARQLLF-- 153
            |.|..|.|   ||..:..|.|:   :||...|.|..             :.....:|..|.:.  
plant    36 SRWELAVSLGVFLVFSSGLCCIYMTMPAAEFGKLKLPRSLADLRLLKDNLANYANEYPAQFVLGY 100

  Fly   154 ---WIEMQNAWITFAVYMGLFALVSFPVVVGYFVLLITAGYLFGCLRGWVTVILGANIGIAVAHA 215
               :|.||...|...::|.|.                 ||.|||..:|.|.|:..|..|     |
plant   101 CATYIFMQTFMIPGTIFMSLL-----------------AGALFGVFKGVVLVVFNATAG-----A 143

  Fly   216 TIRSCRHRIPVQRLIKNDTGRAI--------LRVISG------PKAFRVVLFTRLTPIPFGVQNV 266
            |  ||   ..:.:||    ||.:        ||....      .|....:||.|:||.   :.|:
plant   144 T--SC---FFLSKLI----GRPLITWLWPDKLRFFQAEISKRRDKLLNYMLFLRITPT---LPNL 196

  Fly   267 IFGISS-INTRDYHV---ATLIGLLPAQTINVYLGSTLRSMHEVLSDNDTK 313
            ...::| |....:||   ||||||:||..|.|..|..:..:..|....|.|
plant   197 FINLASPIVDVPFHVFFLATLIGLIPAAYITVRAGLAIGDLKSVKDLYDFK 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 52/187 (28%)
SNARE_assoc 180..298 CDD:286425 41/135 (30%)
AT1G71940NP_001185376.1 TVP38 74..239 CDD:223475 50/198 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.