DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and AT1G44960

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_175116.2 Gene:AT1G44960 / 841061 AraportID:AT1G44960 Length:261 Species:Arabidopsis thaliana


Alignment Length:244 Identity:51/244 - (20%)
Similarity:89/244 - (36%) Gaps:30/244 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 VPATILGALVFI---------GWATRDYARQLLFWIEMQNAWI--TFAVYMGLFALVSFPVVVGY 182
            :.||:  |::.|         ||.......:|..|.:....|.  |:.....:...:..|..|.:
plant     7 IAATV--AIIAIIVRQGTTQYGWNKEAALEKLKEWSDRLGIWAIPTYVAVHTITLALCLPHAVFF 69

  Fly   183 FVLLITAGYLFGCLRGWVTV----ILGANIGIAVAHATIRSCRHRIPVQRLIK--NDTGRAILRV 241
            ..   .|..|||.|...:.|    :|.|:....:.....:|...........|  |...|.:.| 
plant    70 EA---GASMLFGFLPALLCVFSAKVLAASFSFWIGRFVFKSSTRATGWAHSNKYFNILSRGVER- 130

  Fly   242 ISGPKAFRVVLFTRLTPIPFGVQNVIFGISSIN-TRDYHVATLIGLLPAQTINVYLGSTL-RSMH 304
                ..::.||..|.:|||..|.|.....:.:. ..|:...|:||.||....|..:||.. .::.
plant   131 ----DGWKFVLLARFSPIPSYVINYALAATEVRFVADFLFPTVIGCLPMILQNASVGSLAGMAVA 191

  Fly   305 EVLSDNDTKLTGYISFLFEVICGVALMFWVLQKARKELSETLLSADYNN 353
            .|.....:::.||:..:..::..| |:...::|....::|.......||
plant   192 SVAGKQKSQVWGYVFPVLGILSSV-LISLRIKKYSAGITEASSDTSANN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 42/199 (21%)
SNARE_assoc 180..298 CDD:286425 29/124 (23%)
AT1G44960NP_175116.2 VTT 63..185 CDD:378149 31/129 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1327131at2759
OrthoFinder 1 1.000 - - FOG0003179
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.