DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and AT1G03260

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_171825.3 Gene:AT1G03260 / 839546 AraportID:AT1G03260 Length:274 Species:Arabidopsis thaliana


Alignment Length:245 Identity:61/245 - (24%)
Similarity:108/245 - (44%) Gaps:22/245 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LGCLVPATILGALVFIGWATRDYARQLLFWIEMQNAWITFAVYMGLF-----ALVSFP---VVVG 181
            :..|:...|:.|::|:  ......:..|.||:..         :|.|     ||...|   |.|.
plant    15 ISLLLLVAIVSAVIFL--PVEQKLKDFLLWIKED---------LGPFGPLALALAYIPLTIVAVP 68

  Fly   182 YFVLLITAGYLFGCLRGWVTVILGANIGIAVAHATIRSCRHRIPVQRLIKNDTGRAILRVISGPK 246
            ..||.:..|||||...|:|...|||.:|...|....|:. .:..|...||:......:.|.....
plant    69 ASVLTLGGGYLFGLPVGFVADSLGATLGATAAFLLGRTI-GKSYVTSKIKHYPKFQAVSVAIQKS 132

  Fly   247 AFRVVLFTRLTPI-PFGVQNVIFGISSINTRDYHVATLIGLLPAQTINVYLGSTLRSMHEVLSD- 309
            .|::||..|:.|| ||.:.|.:..::.:...:|.:||.:|::|.....||:|:||:.:.::... 
plant   133 GFKIVLLLRVVPILPFNMLNYLLSVTPVRLGEYMLATWLGMMPITFALVYVGTTLKDLSDITHGW 197

  Fly   310 NDTKLTGYISFLFEVICGVALMFWVLQKARKELSETLLSADYNNEGKHPD 359
            ::..:..::..:..|...|.|:..:.:.|:..|.:.|.......:||..|
plant   198 HEVSVFRWVIMMVGVALAVILIICITRVAKSSLDKALAENGTELDGKKND 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 52/199 (26%)
SNARE_assoc 180..298 CDD:286425 36/118 (31%)
AT1G03260NP_171825.3 TVP38 8..219 CDD:223475 54/215 (25%)
DedA 34..227 CDD:223659 51/202 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4151
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I2477
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1327131at2759
OrthoFinder 1 1.000 - - FOG0003179
OrthoInspector 1 1.000 - - otm2841
orthoMCL 1 0.900 - - OOG6_101862
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.