DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and AT1G22850

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_564182.1 Gene:AT1G22850 / 838890 AraportID:AT1G22850 Length:344 Species:Arabidopsis thaliana


Alignment Length:219 Identity:59/219 - (26%)
Similarity:99/219 - (45%) Gaps:27/219 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 GCLVPATILGALVFIGWATRD----YARQLLFWIE---MQNAWITFAVYMGL--FALVSFPVVVG 181
            |.|:..|: |....:|:..||    :..|...:||   .....:..|||.||  .|:.:.|    
plant   113 GVLLIGTV-GGFAGVGYVYRDQINTFLTQFSTYIEGYGTAGYALFIAVYAGLEILAIPALP---- 172

  Fly   182 YFVLLITAGYLFGCLRGWVTVILGANIGIAVAHATIR-SCRHRIPVQRLIKNDTGRAILRVISGP 245
               |.::||.|||.|.|.:.|.:...:..:||....| ..|.||  .:|::::.....:....|.
plant   173 ---LTMSAGLLFGPLIGTIIVSISGTMAASVAFLIARYFARERI--LKLVEDNKKFLAIDKAIGE 232

  Fly   246 KAFRVVLFTRLTP-IPFGVQNVIFGISSINTRDYHVATLIGLLPAQTINVYLGSTLRSMHEVLSD 309
            ..||||...||:| :||.:.|.::|::|:....|.:.:.:|:||.....|..|:..|::.:..|:
plant   233 NGFRVVTLLRLSPLLPFSLGNYLYGLTSVKFVPYVLGSWLGMLPGSWAYVSAGAFGRAIIQEESN 297

  Fly   310 ------NDTKLTGYISFLFEVICG 327
                  |...||..:..|...:.|
plant   298 VGLPGGNGQLLTLGVGLLVTALAG 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 52/191 (27%)
SNARE_assoc 180..298 CDD:286425 34/119 (29%)
AT1G22850NP_564182.1 TVP38 114..301 CDD:223475 53/196 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4151
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1327131at2759
OrthoFinder 1 1.000 - - FOG0003179
OrthoInspector 1 1.000 - - otm2841
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.