DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11367 and AT1G09300

DIOPT Version :9

Sequence 1:	NP_649412.1	Gene:	CG11367 / 40491	FlyBaseID:	FBgn0037185	Length:	362	Species:	Drosophila melanogaster
Sequence 2:	NP_172401.2	Gene:	AT1G09300 / 837451	AraportID:	AT1G09300	Length:	493	Species:	Arabidopsis thaliana

Alignment Length:	47	Identity:	13/47 - (27%)
Similarity:	20/47 - (42%)	Gaps:	8/47 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly   306 VLSDNDTKLTGYISFLFEV--ICGVALMFWVLQKARKELSETLLSAD 350
            ||.|...:|.||:|.|...  .||      .....::||.:.:|..:
plant   293 VLMDMGCELHGYVSDLTRTWPPCG------KFSSVQEELYDLILQTN 333

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11367	NP_649412.1	DedA	150..340	CDD:223659	10/35 (29%)
CG11367	NP_649412.1	SNARE_assoc	180..298	CDD:286425
AT1G09300	NP_172401.2	AMP_N	57..173	CDD:310065
AT1G09300	NP_172401.2	Prolidase	217..448	CDD:238520	13/47 (28%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0006
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900