DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and AT5G19070

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_197408.2 Gene:AT5G19070 / 832026 AraportID:AT5G19070 Length:280 Species:Arabidopsis thaliana


Alignment Length:238 Identity:64/238 - (26%)
Similarity:103/238 - (43%) Gaps:13/238 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 WGRAHSFLTRNWYLGCLVPATILGALVFIGWATRDYARQLLFWIEMQ-NAWITFAVYMGLFALVS 175
            ||.|    .|...|..||.|.:| |..|:  ......:..|.|:|.. ..|..||:.:....|..
plant     5 WGSA----LRISVLLILVAAIVL-ACYFL--PVEKLLKDFLLWVEQDLGPWGPFALAVAYIPLTV 62

  Fly   176 FPVVVGYFVLLITAGYLFGCLRGWVTVILGANIGIAVAHATIRSCRHRIPVQRLIKNDTGRAILR 240
            ..|...  ||.:..|||||...|:|...:||.:|...|....|:......|.:|......:::..
plant    63 LAVPAS--VLTLGGGYLFGLPIGFVADSVGATLGSGAAFLLGRTIGKPFVVAKLKDYPQFQSVAL 125

  Fly   241 VISGPKAFRVVLFTRLTP-IPFGVQNVIFGISSINTRDYHVATLIGLLPAQTINVYLGSTLRSMH 304
            .|. ...|::.|..||.| :||.:.|.:..::.|....|.:::.:|::|.....||:|:||:.:.
plant   126 AIE-KSGFKICLLLRLAPLLPFSMLNYLLSVTPIRLGPYLLSSWLGMMPITLALVYVGTTLKDLS 189

  Fly   305 EVLSDNDTKLTGYISFLF-EVICGVALMFWVLQKARKELSETL 346
            :|.........|..:||. .::..|.||..|.:.|:..|.:.|
plant   190 DVTHKWSEFSPGRWAFLISSLVISVILMVCVTKVAKDALRKAL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 51/192 (27%)
SNARE_assoc 180..298 CDD:286425 31/118 (26%)
AT5G19070NP_197408.2 TVP38 8..188 CDD:223475 51/189 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4151
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I2477
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1327131at2759
OrthoFinder 1 1.000 - - FOG0003179
OrthoInspector 1 1.000 - - otm2841
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.930

Return to query results.
Submit another query.