DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and AT4G22850

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_194016.2 Gene:AT4G22850 / 828384 AraportID:AT4G22850 Length:296 Species:Arabidopsis thaliana


Alignment Length:258 Identity:57/258 - (22%)
Similarity:108/258 - (41%) Gaps:44/258 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 TRNWY------LGCLVPATILGALVFIGWATRDYARQLLFWIEMQNAWITFAVYMGLFALVS--- 175
            :|.|:      |...:.|..:...::||....|  ::|:..|:.:....|..| .||....|   
plant    51 SRFWFWVKLSLLFAFLAALAVVGYIWIGPLIMD--KELIPLIQWEIRTFTHPV-CGLLVFASVAI 112

  Fly   176 FPVVVGYFVLLIT-----AGYLFGCLRGWVTVILGANIGIAVAH-------ATIRSCRHRIPVQR 228
            ||.:    :|..|     ||..||...|::.:|..|.:|:::.:       ..|:....|.|.|.
plant   113 FPTI----LLPSTPSMWIAGMTFGYGYGFLLIISAAAVGVSLPYFIGQLFCHKIQGWLERYPDQA 173

  Fly   229 LIKNDTGRAILRVISGPKAFRVVLFTRLTPIPFGVQNVIFGISSINTR----DYHVATLIGLLPA 289
            .:....|..     :....|.:|...|::|.|:    :::...|:.||    .|...:|:|::|.
plant   174 AVLRAAGEG-----NWLHQFLLVTLIRISPFPY----ILYNYCSVATRVKYGPYITGSLLGMVPE 229

  Fly   290 QTINVYLGSTLRSMHEVLS--DNDTKLTGYISFLFEVICGVALMFWVLQKARKELSETLLSAD 350
            ..:.:|.|..:|::.|..|  :....:|..|..:...:..||....:.:.|:::| ||:...|
plant   230 VFVAIYTGILVRTLAEASSAEEQGLSVTQVILNILGFLATVATTILITKYAKRQL-ETMKKED 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 46/210 (22%)
SNARE_assoc 180..298 CDD:286425 28/133 (21%)
AT4G22850NP_194016.2 DedA 81..282 CDD:223659 47/216 (22%)
SNARE_assoc 118..239 CDD:286425 29/129 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.