DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and AT4G17790

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_567541.1 Gene:AT4G17790 / 827501 AraportID:AT4G17790 Length:264 Species:Arabidopsis thaliana


Alignment Length:177 Identity:48/177 - (27%)
Similarity:67/177 - (37%) Gaps:51/177 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 TRDYARQL-----LFWIEMQNAWITFAVYMGLFALVSFPVVVGYFVLLITAGYLFGCLRGWVTVI 203
            |.||..|:     |.::.||...|...|:|.|.                 ||.|||.::|...|:
plant    83 TSDYTVQVLVGYCLVYVFMQTFMIPGTVFMSLL-----------------AGALFGVVKGMALVV 130

  Fly   204 LGANIGIAVAHATIRSCRHRIPVQRLIKNDTGRAILRVISGPK--------------AFRVVLFT 254
            ..|..|.:       ||..   :.:||    ||.:|..:...|              ....:||.
plant   131 STATAGAS-------SCYF---LSKLI----GRPLLFSLWPDKLVFFQDQVARRKDRLLNYMLFL 181

  Fly   255 RLTP-IPFGVQNVIFGISSINTRDYHVATLIGLLPAQTINVYLGSTL 300
            |||| :|....||...|..:....:.:||.|||:||..:.|..|..|
plant   182 RLTPTLPNTFINVASPIVDVPYHIFFLATFIGLIPAAFVTVRAGLAL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 45/171 (26%)
SNARE_assoc 180..298 CDD:286425 35/132 (27%)
AT4G17790NP_567541.1 TVP38 <91..228 CDD:223475 43/167 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.