DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and AT4G09580

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_192696.3 Gene:AT4G09580 / 826542 AraportID:AT4G09580 Length:287 Species:Arabidopsis thaliana


Alignment Length:247 Identity:72/247 - (29%)
Similarity:99/247 - (40%) Gaps:76/247 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 VPATI---------LGALVFIGWATRDYARQLL----FWIEMQNAWITFAVYMGLFALVSFPVVV 180
            ||.||         ||:     :|:...||.:|    .:|.||...|...::|.|.         
plant    86 VPRTISDLRLLKENLGS-----YASEYQARFILGYCSTYIFMQTFMIPGTIFMSLL--------- 136

  Fly   181 GYFVLLITAGYLFGCLRGWVTVILGANIGIAVAHATIRSCRHRIPVQRLIKNDTGRAI------- 238
                    ||.|||.:||:|.|:|.|..|..       ||   ..:.:|:    ||.:       
plant   137 --------AGALFGVVRGFVLVVLNATAGAC-------SC---FFLSKLV----GRPLVNWLWPE 179

  Fly   239 -LRVISGPKAFR------VVLFTRLTPIPFGVQNVIFGISS-INTRDYHV---ATLIGLLPAQTI 292
             ||......|.|      .:||.|:||.   :.|:...:|| |....:||   |||:||:||..|
plant   180 KLRFFQAEIAKRRDRLLNYMLFLRITPT---LPNLFINLSSPIVDIPFHVFFLATLVGLMPASYI 241

  Fly   293 NVYLGSTLRSMHEVLSDNDTKLTGYISFLFEVICGVALMFWVLQKARKELSE 344
            .|..|..|..:..|....|.|.   :|.||  :.|...:|..|.| ||.:.|
plant   242 TVRAGLALGDLRSVKDLYDFKT---LSVLF--LIGSISIFPALLK-RKRVYE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 60/211 (28%)
SNARE_assoc 180..298 CDD:286425 41/135 (30%)
AT4G09580NP_192696.3 SNARE_assoc 104..284 CDD:412374 64/219 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.