DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and AT3G05350

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_187186.5 Gene:AT3G05350 / 819699 AraportID:AT3G05350 Length:710 Species:Arabidopsis thaliana


Alignment Length:405 Identity:84/405 - (20%)
Similarity:127/405 - (31%) Gaps:138/405 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SCNNNNNYKNKTTY-----GYSNNNDTNCIMQKPVPASTAPAF-----------PQLIQASC--- 47
            |.|..:..|.||.:     ||: .|.:...||.|:  |.|.|.           ..|..|:.   
plant   372 SRNFESEAKVKTKFTDSSSGYT-ANPSGIYMQSPI--SWAKAIKNDAELKGMKNSHLRDAAALAH 433

  Fly    48 ------------SNAVEVDPPDSIVGAAGNSEALFAAQRTPDTSEDSECDPFLASRRATRSSATT 100
                        :|..|||..|.::......:...      |||.|:          .:.|.|..
plant   434 FWAWLEEEVHKNANLTEVDVADRLLEFRSMQDGFM------DTSFDT----------ISGSGANG 482

  Fly   101 SVLHNRKRNSCWGRAHS---FLTRNWYLGCLVPATILGALVFIGWATRDYARQLLFWIEMQNAWI 162
            :::|.:.......|...   ||..:            ||....|  |.|..|.:.|.........
plant   483 AIIHYKPEPESCSRVDPQKLFLLDS------------GAQYVDG--TTDITRTVHFSEPSAREKE 533

  Fly   163 TFA-VYMGLFAL--VSFPVVVGYFVLLITAGYLFGCLRGWVTVILGANIGIAVAHATIRSCRHRI 224
            .|. |..|..||  ..||.....|||   .|:....|  |       .||:...|.|    .|.:
plant   534 CFTRVLQGHIALDQAVFPEGTPGFVL---DGFARSSL--W-------KIGLDYRHGT----GHGV 582

  Fly   225 PVQRLIKNDTGRAILRVISGPK--AFRVVLFTRLTPIPFGV---------QNVIFGISSINTRDY 278
                       .|.|.|..||:  :||   :..:||:..|:         ::..|||        
plant   583 -----------GAALNVHEGPQSISFR---YGNMTPLQNGMIVSNEPGYYEDHAFGI-------- 625

  Fly   279 HVATLIGLLPAQTINVYLGSTLRSMHE--------------VLSDNDTK-LTGYISFLFEVIC-- 326
            .:..|:.:..|:|.|.:.|:|.....:              :|||.:.. |..|.:.::|.:.  
plant   626 RIENLLHVRDAETPNRFGGATYLGFEKLTFFPIQTKMVDVSLLSDTEVDWLNSYHAEVWEKVSPL 690

  Fly   327 --GVALMFWVLQKAR 339
              |.....|:....|
plant   691 LEGSTTQQWLWNNTR 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 47/223 (21%)
SNARE_assoc 180..298 CDD:286425 28/128 (22%)
AT3G05350NP_187186.5 Creatinase_N 96..206 CDD:307473
Creatinase_N_2 230..416 CDD:318430 14/46 (30%)
APP 419..643 CDD:238518 59/291 (20%)
Peptidase_M24_C 646..707 CDD:318429 10/60 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.