DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and AT2G02370

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001077870.1 Gene:AT2G02370 / 814768 AraportID:AT2G02370 Length:320 Species:Arabidopsis thaliana


Alignment Length:309 Identity:77/309 - (24%)
Similarity:132/309 - (42%) Gaps:41/309 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 AQRTPDTSEDSECDPFLASRRATRSSATTSVLHNR---KRNSCWGRAHSFLTRNWYLGCLVPATI 133
            |..||. ..|:|....:.:..|:.:....|:..:.   |:...|.:|         ||....|.:
plant    13 ANSTPH-MRDNEYVRLVVAHEASPAETVLSLSQSEVQSKKFMWWLKA---------LGICAVALL 67

  Fly   134 LGALVFIGWATRDYARQLLFWIEMQNAWITFAVYMGLFALVSFPVVVGYFVLLI-------TAGY 191
            | .|||..|......:::|..| :|  |...|....:.|:|....:..:.|.||       .||.
plant    68 L-TLVFGKWGVPFVFQKVLIPI-LQ--WEATAFGRPMLAIVLVVSLALFPVFLIPSGPSMWLAGM 128

  Fly   192 LFGCLRGWVTVILGANIGIAVAHATIRSCRHRIPVQRLIKNDTGRAILRVI---SGPKAFRVVLF 253
            :||...|:|.:::|..||:.:.:......|.|:. |.|.:.....|:||:.   |....||||..
plant   129 IFGYGLGFVIIMVGTTIGMVLPYLIGLMFRDRLH-QWLKRWPRQAAVLRLAAEGSWFHQFRVVAI 192

  Fly   254 TRLTPIPFGVQNVIFGISSINTRDYHVATLIGLLPAQTINVYLGSTLRSMHEVLSDNDTKLT--- 315
            .|::|.|:.:.|....::|:....|...::.|::|...|.:|.|..:|:..:|...:....|   
plant   193 FRVSPFPYTIFNYAIVVTSMRFWPYFFGSIAGMIPEAFIYIYSGRLIRTFADVQYGHQRLTTVEI 257

  Fly   316 --GYISFLFEVICGVALMFWVLQKARKELSETLLSADYNNEGKHPDVQV 362
              ..||.:..|:..||...:    |::.|.| |.:|:.|.:   .:|||
plant   258 VYNVISLVIAVVTTVAFTVY----AKRALRE-LQNAEANED---EEVQV 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 51/204 (25%)
SNARE_assoc 180..298 CDD:286425 34/127 (27%)
AT2G02370NP_001077870.1 TVP38 63..286 CDD:223475 59/232 (25%)
DedA 88..283 CDD:223659 50/202 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2841
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.