Sequence 1: | NP_649412.1 | Gene: | CG11367 / 40491 | FlyBaseID: | FBgn0037185 | Length: | 362 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_003390.4 | Gene: | XPNPEP2 / 7512 | HGNCID: | 12823 | Length: | 674 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 42/201 - (20%) |
---|---|---|---|
Similarity: | 64/201 - (31%) | Gaps: | 52/201 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 MQKPVPASTAPAFPQLIQASCSNAVEVD-----------PPDSIVGAAGNSEALFAAQRTPDTSE 80
Fly 81 DSECDP-FLASRRATRSSATTSVLHNRKRNSCWGRAHSFLTRNWYLGCLVPATILGALVF----I 140
Fly 141 GWATRDYARQLLFWIEMQNAWITFAVYMGLFALVSFPVVVGYFVLLITAGYLFGCLRGWVTVILG 205
Fly 206 ANIGIA 211 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11367 | NP_649412.1 | DedA | 150..340 | CDD:223659 | 11/62 (18%) |
SNARE_assoc | 180..298 | CDD:286425 | 7/32 (22%) | ||
XPNPEP2 | NP_003390.4 | Creatinase_N | 54..184 | CDD:279639 | |
Creatinase_N_2 | 202..361 | CDD:292807 | |||
PepP | <348..601 | CDD:223085 | 42/201 (21%) | ||
APP | 365..583 | CDD:238518 | 42/201 (21%) | ||
Peptidase_M24_C | 585..648 | CDD:292806 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0006 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |