DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and XPNPEP2

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_003390.4 Gene:XPNPEP2 / 7512 HGNCID:12823 Length:674 Species:Homo sapiens


Alignment Length:201 Identity:42/201 - (20%)
Similarity:64/201 - (31%) Gaps:52/201 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MQKPVPASTAPAFPQLIQASCSNAVEVD-----------PPDSIVGAAGNSEALFAAQRTPDTSE 80
            ::|.||..|...|        |.|..||           |....:.|:|.:.||.....|.:.:.
Human   383 LEKNVPKGTVDEF--------SGAEIVDKFRGEEQFSSGPSFETISASGLNAALAHYSPTKELNR 439

  Fly    81 DSECDP-FLASRRATRSSATTSVLHNRKRNSCWGRAHSFLTRNWYLGCLVPATILGALVF----I 140
            ....|. :|..........||.:    .|...||...:| .:..|...|:....|..|:|    .
Human   440 KLSSDEMYLLDSGGQYWDGTTDI----TRTVHWGTPSAF-QKEAYTRVLIGNIDLSRLIFPAATS 499

  Fly   141 GWATRDYARQLLFWIEMQNAWITFAVYMGLFALVSFPVVVGYFVLLITAGYLFGCLRGWVTVILG 205
            |.....:||:.| |    :|.:.:....|        ..:|.|:          |:..|......
Human   500 GRMVEAFARRAL-W----DAGLNYGHGTG--------HGIGNFL----------CVHEWPVGFQS 541

  Fly   206 ANIGIA 211
            .||.:|
Human   542 NNIAMA 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 11/62 (18%)
SNARE_assoc 180..298 CDD:286425 7/32 (22%)
XPNPEP2NP_003390.4 Creatinase_N 54..184 CDD:279639
Creatinase_N_2 202..361 CDD:292807
PepP <348..601 CDD:223085 42/201 (21%)
APP 365..583 CDD:238518 42/201 (21%)
Peptidase_M24_C 585..648 CDD:292806
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.