DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and Tmem64

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_017449188.1 Gene:Tmem64 / 689176 RGDID:1596128 Length:388 Species:Rattus norvegicus


Alignment Length:240 Identity:83/240 - (34%)
Similarity:138/240 - (57%) Gaps:12/240 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 RNWYLGC---------LVPATILGALVFIGWA-TRDYARQLLFWIEMQNAWITFAVYMGLFALVS 175
            |||...|         ||...:|.||.|...| .|.|.:.||.|:|..::.:...:::..|.:||
  Rat   106 RNWRCCCLGSTCWCRSLVLVCVLAALCFASLALVRRYLQHLLLWVESLDSLLGVLLFVVGFIVVS 170

  Fly   176 FPVVVGYFVLLITAGYLFGCLRGWVTVILGANIGIAVAHATIRSCRHRIPVQRLIKNDTGRAILR 240
            ||...||.||.:.||||:|.:.|...:::|..||..:||...:.........|:..:|...|::|
  Rat   171 FPCGWGYIVLNVAAGYLYGFVLGMGLMVVGVLIGTFIAHVVCKRLLTAWVAARIQSSDKLSAVIR 235

  Fly   241 VISGPKAFRVVLFTRLTPIPFGVQNVIFGISSINTRDYHVATLIGLLPAQTINVYLGSTLRSMHE 305
            |:.|....:||...||||||||:||.:|.|:.::..:|.:|:.:||||.|.:|.|||:|||:|.:
  Rat   236 VVEGGSGLKVVALARLTPIPFGLQNAVFSITDLSLPNYLMASSVGLLPTQLLNSYLGTTLRTMED 300

  Fly   306 VLSDNDTKLTGYISFLFEVICGVALMFWVLQKARKELSETLLSAD 350
            |:::.  .::||..|..:::..:.|||:|:.:|:.||:..:::.:
  Rat   301 VIAEQ--SVSGYFVFCLQIVISIGLMFYVVHRAQVELNAAIVACE 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 68/189 (36%)
SNARE_assoc 180..298 CDD:286425 45/117 (38%)
Tmem64XP_017449188.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335611
Domainoid 1 1.000 91 1.000 Domainoid score I7558
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H45636
Inparanoid 1 1.050 156 1.000 Inparanoid score I4206
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1327131at2759
OrthoFinder 1 1.000 - - FOG0003179
OrthoInspector 1 1.000 - - oto96982
orthoMCL 1 0.900 - - OOG6_101862
Panther 1 1.100 - - LDO PTHR46593
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5452
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.