Protein Alignment CG11367 and Xpnpep3

DIOPT Version :9

• Sequence 1: NP_649412.1
• Gene: CG11367 / 40491
• FlyBaseID: FBgn0037185
• Length: 362
• Species: Drosophila melanogaster
• Sequence 2: NP_001124054.3
• Gene: Xpnpep3 / 685823
• RGDID: 1589063
• Length: 506
• Species: Rattus norvegicus
• Alignment Length: 53
• Identity: 17/53 - (32%)
• Similarity: 26/53 - (49%)
• Gaps: 6/53 - (11%)

  Fly   211 AVAHATIRSCRHRIPVQRLIKNDTGRAILRV-ISG---PKAFRVVLFTRLTPI 259
            |.:...:||.:|.|...||||:..  .|.|: |:|   .:||...:|....|:
  Rat   227 ATSKNKVRSVQHLIQHLRLIKSPA--EIKRMQIAGKLTSEAFIETMFASKAPV 277

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
CG11367	NP_649412.1	DedA	150..340	CDD:223659	17/53 (32%)
		SNARE_assoc	180..298	CDD:286425	17/53 (32%)
Xpnpep3	NP_001124054.3	Interaction with TNFRSF1B. /evidence=ECO:0000250|UniProtKB:Q9NQH7	54..79
		AMP_N	67..206	CDD:198079
		Prolidase	252..489	CDD:238520	8/26 (31%)

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0006
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900