DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and Tmem41a

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_079969.1 Gene:Tmem41a / 66664 MGIID:1913914 Length:264 Species:Mus musculus


Alignment Length:242 Identity:50/242 - (20%)
Similarity:85/242 - (35%) Gaps:68/242 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 RDYARQLLFWIEMQNAWITFAVYMGLFALVSFPVVVGYFVLLITAGYLFGCLRGWVTVILGANIG 209
            |:|.::       ..|:: |.::...:.......:.|...|.:.||.|||...|.:...:..::|
Mouse    59 REYRKE-------HQAYV-FLLFCSAYLYKQGFAIPGSSFLNVLAGALFGPWLGLLLCCVLTSVG 115

  Fly   210 IAVAHATIRSCRHRIPVQRLIKNDTGRAILRVISGPK-----------------------AFRVV 251
            .                       ||..:|..:.|.:                       .|..:
Mouse   116 A-----------------------TGCYLLSSLFGKQLVISYFPDKVALLQKKVEENRNSLFFFL 157

  Fly   252 LFTRLTPI-PFGVQNVIFGISSINTRDYHVATLIGLLPAQTINVYLGSTLRSMHEVLSDNDTKLT 315
            ||.||.|: |....|:...|.:|....:..:.||||:|...|.|..||.|.::        |.|.
Mouse   158 LFLRLFPMTPNWFLNLSAPILNIPIVQFFFSVLIGLIPYNFICVQTGSILSTL--------TSLD 214

  Fly   316 GYISFLFEVI---CGVALMFWVLQKARKELSETLLSADYNNEGKHPD 359
            ..  |.:|.:   ..:||:..|.....|:.|:..|:....::..|||
Mouse   215 AL--FSWETVLKLLAIALVALVPGTLIKKFSQKRLALSETSDIGHPD 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 42/216 (19%)
SNARE_assoc 180..298 CDD:286425 30/141 (21%)
Tmem41aNP_079969.1 SNARE_assoc 85..205 CDD:286425 30/142 (21%)
VTT domain. /evidence=ECO:0000250|UniProtKB:Q96HV5 96..207 29/133 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.