DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and tmem41aa

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001018601.1 Gene:tmem41aa / 553803 ZFINID:ZDB-GENE-050522-53 Length:281 Species:Danio rerio


Alignment Length:152 Identity:39/152 - (25%)
Similarity:55/152 - (36%) Gaps:43/152 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 GYFVLLITAGYL------------------------FGCLRGWVTVILGANIGIAVAHATIRSCR 221
            ||.:||..:.||                        ||.|...|...:||.:...::.|   ..:
Zfish    84 GYVLLLFCSAYLYKQAFAIPGSSFLNILAGALFGTWFGLLLTCVLTTVGATLCFLLSQA---FGK 145

  Fly   222 HRI------PVQRLIKN-DTGRAILRVISGPKAFRVVLFTRLTPI-PFGVQNVIFGISSINTRDY 278
            |.|      .|..|.|. :..|:.|        |..:||.|..|: |....|:...|.:|....:
Zfish   146 HHIVKLFPDKVAMLQKKVEENRSSL--------FFFLLFLRFFPMSPNWFLNMTSPILNIPVTLF 202

  Fly   279 HVATLIGLLPAQTINVYLGSTL 300
            .:|..|||:|...|.|..||.|
Zfish   203 FMAVFIGLMPYNFICVQTGSML 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 39/152 (26%)
SNARE_assoc 180..298 CDD:286425 36/148 (24%)
tmem41aaNP_001018601.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..56
SNARE_assoc 102..223 CDD:286425 31/131 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.