DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and tmem41b

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001016955.1 Gene:tmem41b / 549709 XenbaseID:XB-GENE-978007 Length:278 Species:Xenopus tropicalis


Alignment Length:210 Identity:40/210 - (19%)
Similarity:84/210 - (40%) Gaps:45/210 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 FWIEMQNAWITFAVYMGLFALVSFPVVVGYFVLLITAGYLFGCLRGWVTVILGANIGIAVAHATI 217
            |::|:..|:.|..:::..||      :.|...|.|.:|:|:........|.|.:.:|.:..:   
 Frog    96 FYVEVLVAYFTTYIFLQTFA------IPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFCY--- 151

  Fly   218 RSCRHRIPVQRLIKNDTGRAILRVISGPKAFR--------------VVLFTRLTP-IPFGVQNVI 267
                       |:....||.::......||.:              .::|.|:|| :|....|:.
 Frog   152 -----------LLSYLVGRPVVYKYLSDKAIKWSQQVERHRDHLINYIIFLRITPFLPNWFINIT 205

  Fly   268 FGISSINTRDYHVATLIGLLPAQTINVYLGSTLRSM---HEVLSDNDTKLTGYISFLFEVICGVA 329
            ..:.::..:.:.:.|.||:.|...:.:..|:||..:   .|.:|.|..       .:..|:..::
 Frog   206 SPVINVPLKVFFLGTFIGVAPPSFVAIKAGTTLYQLTTAGEAVSWNSV-------IILMVLAVLS 263

  Fly   330 LMFWVLQKARKELSE 344
            ::..:.||..|:..|
 Frog   264 ILPAIFQKKLKKKFE 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 38/204 (19%)
SNARE_assoc 180..298 CDD:286425 23/132 (17%)
tmem41bNP_001016955.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
VTT 116..235 CDD:378149 23/132 (17%)
VTT domain, required for its function in autophagy. /evidence=ECO:0000250|UniProtKB:Q5BJD5 127..238 21/124 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.