DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and Dip-C

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001287306.1 Gene:Dip-C / 47769 FlyBaseID:FBgn0000455 Length:491 Species:Drosophila melanogaster


Alignment Length:34 Identity:9/34 - (26%)
Similarity:13/34 - (38%) Gaps:0/34 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 GCLRGWVTVILGANIGIAVAHATIRSCRHRIPVQ 227
            ||.....|.|.|:....::.|.......:..|||
  Fly   238 GCRHASYTCICGSGTNSSILHYGHAGAPNSKPVQ 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 9/34 (26%)
SNARE_assoc 180..298 CDD:286425 9/34 (26%)
Dip-CNP_001287306.1 AMP_N 12..158 CDD:198079
PRK10879 57..483 CDD:182804 9/34 (26%)
Prolidase 195..468 CDD:238520 9/34 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.