DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11367 and CG6225

DIOPT Version :9

Sequence 1:	NP_649412.1	Gene:	CG11367 / 40491	FlyBaseID:	FBgn0037185	Length:	362	Species:	Drosophila melanogaster
Sequence 2:	NP_001097759.1	Gene:	CG6225 / 41559	FlyBaseID:	FBgn0038072	Length:	704	Species:	Drosophila melanogaster

Alignment Length:	131	Identity:	23/131 - (17%)
Similarity:	46/131 - (35%)	Gaps:	44/131 - (33%)

- Green bases have known domain annotations that are detailed below.

  Fly   230 IKN-----DTGRAILRVISGPKAFRVVLFTRLTPIPFGVQNVIFGISSINTRDYHVATLIGLLPA 289
            :||     |||.      :.|...|.:.|..:|.:|:..:
  Fly   578 LKNVLEVVDTGH------THPSGARFLAFRDVTMVPYEPK------------------------- 611

  Fly   290 QTINVYLGSTLRSMHE--VLSDNDTKLTGYISFLFEVICGVALMFWVLQKARKELSETLLSADYN 352
                 .:.|||.|..|  :|::.:.|:...|....:.:..:...:|::.:.| .:.|.|...:|.
  Fly   612 -----LIDSTLLSAAEKRLLNEYNAKIRNDIGDELKRLGNMRAFYWMMNQTR-HIREYLPEDEYR 670

  Fly   353 N 353
            :
  Fly   671 S 671

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11367	NP_649412.1	DedA	150..340	CDD:223659	19/116 (16%)
CG11367	NP_649412.1	SNARE_assoc	180..298	CDD:286425	10/72 (14%)
CG6225	NP_001097759.1	Creatinase_N	92..195	CDD:304957
		Creatinase_N_2	209..368	CDD:292807
		PepP	213..589	CDD:223085	4/10 (40%)
		APP	371..594	CDD:238518	6/21 (29%)
		Peptidase_M24_C	597..660	CDD:292806	13/93 (14%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0006
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.900