powered by:
Protein Alignment CG11367 and xpnpep1
DIOPT Version :9
Sequence 1: | NP_649412.1 |
Gene: | CG11367 / 40491 |
FlyBaseID: | FBgn0037185 |
Length: | 362 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021324983.1 |
Gene: | xpnpep1 / 406253 |
ZFINID: | ZDB-GENE-040426-999 |
Length: | 625 |
Species: | Danio rerio |
Alignment Length: | 33 |
Identity: | 8/33 - (24%) |
Similarity: | 15/33 - (45%) |
Gaps: | 3/33 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 NCIMQKPVP---ASTAPAFPQLIQASCSNAVEV 53
:|.:.:.:| .|..|..|..:..:..||.|:
Zfish 300 SCALTQAIPKSHRSAIPYTPLCLAKAVKNATEI 332
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0006 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.