DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and xpnpep1

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_021324983.1 Gene:xpnpep1 / 406253 ZFINID:ZDB-GENE-040426-999 Length:625 Species:Danio rerio


Alignment Length:33 Identity:8/33 - (24%)
Similarity:15/33 - (45%) Gaps:3/33 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NCIMQKPVP---ASTAPAFPQLIQASCSNAVEV 53
            :|.:.:.:|   .|..|..|..:..:..||.|:
Zfish   300 SCALTQAIPKSHRSAIPYTPLCLAKAVKNATEI 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659
SNARE_assoc 180..298 CDD:286425
xpnpep1XP_021324983.1 Creatinase_N 15..159 CDD:329087
Creatinase_N_2 162..331 CDD:318430 7/30 (23%)
APP 334..555 CDD:238518
Peptidase_M24_C 562..624 CDD:318429
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.