DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11367 and xpnpep2

DIOPT Version :9

Sequence 1:	NP_649412.1	Gene:	CG11367 / 40491	FlyBaseID:	FBgn0037185	Length:	362	Species:	Drosophila melanogaster
Sequence 2:	NP_957326.2	Gene:	xpnpep2 / 394007	ZFINID:	ZDB-GENE-040426-1151	Length:	703	Species:	Danio rerio

Alignment Length:	101	Identity:	21/101 - (20%)
Similarity:	42/101 - (41%)	Gaps:	29/101 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly   271 SSINTRDYHVATLIGLLPAQTINVYLGS--TLRSMHEVLSDNDTKLTGYIS-------------- 319
            ||:.|      .|...|....:.|::|:  |.::::|:::..|..||...|
Zfish   331 SSVRT------YLQSYLQRPNVRVWVGTEYTNQALYELITPEDKLLTSTYSPVLTTKAVKDMTEQ 389

  Fly   320 ------FLFEVICGVALMFWVLQKARKELSETLLSA 349
                  .:.:.:..:.|:.| |:|...|.:||.::|
Zfish   390 RILKEAHVRDAVAVMQLLLW-LEKKVPEGAETEITA 424

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11367	NP_649412.1	DedA	150..340	CDD:223659	17/90 (19%)
CG11367	NP_649412.1	SNARE_assoc	180..298	CDD:286425	6/26 (23%)
xpnpep2	NP_957326.2	Creatinase_N	79..209	CDD:279639
		Creatinase_N_2	232..388	CDD:292807	13/62 (21%)
		PepP	261..628	CDD:223085	21/101 (21%)
		APP	392..611	CDD:238518	8/34 (24%)
		Peptidase_M24_C	611..675	CDD:292806
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0006
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900