DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and ApepP

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001246053.1 Gene:ApepP / 35029 FlyBaseID:FBgn0026150 Length:613 Species:Drosophila melanogaster


Alignment Length:283 Identity:67/283 - (23%)
Similarity:87/283 - (30%) Gaps:98/283 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 DTSEDSECDPFLASRRATRS-----SATT--------SVLH-------NRKRNSCWGRAHSFLTR 121
            :..|.|..|. |.|.|:|:.     |.||        ||:|       |||.|.          :
  Fly   349 EVDEMSGADK-LESFRSTKDKYMGLSFTTISASGPNGSVIHYHPKKETNRKIND----------K 402

  Fly   122 NWYLGCLVPATILGALVFIGWATRDYARQLLFW--IEMQNAWITFAVYMGL-FALVSFPVVVGYF 183
            ..|| |...|..|.       .|.|..|.|.|.  .|.|....|..:...| |....||..|...
  Fly   403 EIYL-CDSGAQYLD-------GTTDVTRTLHFGEPTEFQKEAYTRVLKGQLSFGSTVFPAKVKGQ 459

  Fly   184 VLLITAGYLFGCLRGWVTVILGANIGIAVAHATIRSCRHRIPVQ--------RLIKNDTGRAILR 240
            ||...|....     |       ::|:...|.|.....|.:.|.        ||:.:|.|.....
  Fly   460 VLDTLARKAL-----W-------DVGLDYGHGTGHGVGHFLNVHEGPMGVGIRLMPDDPGLQANM 512

  Fly   241 VISGPKAFRVVLFTRLTPIPFGVQNVIFGISSINTRDYHVATLIGLLPAQ--------------T 291
            .||....|              .|:..|||        .|..::.::|.|              |
  Fly   513 FISNEPGF--------------YQDGEFGI--------RVEDIVQIVPGQVAHNFSNRGALTFKT 555

  Fly   292 INVYLGSTLRSMHEVLSDNDTKL 314
            |.:....|.....|:|||.:.||
  Fly   556 ITMCPKQTKMIKKELLSDAEVKL 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 42/190 (22%)
SNARE_assoc 180..298 CDD:286425 26/139 (19%)
ApepPNP_001246053.1 Creatinase_N 9..154 CDD:307473
Creatinase_N_2 158..318 CDD:318430
APP 321..545 CDD:238518 58/248 (23%)
Peptidase_M24_C 551..613 CDD:318429 9/28 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.