DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and CG9581

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_608376.1 Gene:CG9581 / 33017 FlyBaseID:FBgn0031093 Length:545 Species:Drosophila melanogaster


Alignment Length:106 Identity:24/106 - (22%)
Similarity:37/106 - (34%) Gaps:20/106 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TAPAFPQLIQASCSNAVEVDPPDSIVGAAGNSEALFAAQRTPDTSED--SECDPFLASRRATRSS 97
            |:.:.|.|||           ||.:|.....:|   ..:|.....::  :....|........||
  Fly    71 TSVSHPHLIQ-----------PDELVPGVELTE---IKERRSQLMQNIRAYARSFGGEFNGHSSS 121

  Fly    98 ATTSVLHNRKRNSCWGRAHSFLTRN---WYL-GCLVPATIL 134
            ....||....:....|:......:|   :|| |||.|..:|
  Fly   122 CHMLVLGAASKKYMSGKIPYVFRQNSDFYYLTGCLEPDAVL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659
SNARE_assoc 180..298 CDD:286425
CG9581NP_608376.1 AMP_N 94..232 CDD:282980 15/69 (22%)
Prolidase 274..517 CDD:238520
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.