DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and stas

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_573225.1 Gene:stas / 32737 FlyBaseID:FBgn0030850 Length:320 Species:Drosophila melanogaster


Alignment Length:148 Identity:38/148 - (25%)
Similarity:57/148 - (38%) Gaps:24/148 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 VSFPVVVGYFVLLITA--GYLFGCLRGWVTVILGANIGIAVAHATIRSCRH-RIPVQRLIKNDTG 235
            |.|.|||.|..|...|  |.||      ::::||......:|...|..|.. ...:...:.|..|
  Fly   141 VMFGVVVAYVFLQTFAIPGSLF------LSILLGFLYKFPIALFLICFCSALGATLCYTLSNLVG 199

  Fly   236 RAILRVISGPKA--------------FRVVLFTRLTPI-PFGVQNVIFGISSINTRDYHVATLIG 285
            |.::|.....|.              |..:||.|:||| |....|:...:..:....:.:.|..|
  Fly   200 RRLIRHFWPKKTSEWSKHVEEYRDSLFNYMLFLRMTPILPNWFINLASPVIGVPLHIFALGTFCG 264

  Fly   286 LLPAQTINVYLGSTLRSM 303
            :.|...|.:..|.||:.|
  Fly   265 VAPPSVIAIQAGKTLQKM 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 38/148 (26%)
SNARE_assoc 180..298 CDD:286425 30/135 (22%)
stasNP_573225.1 SNARE_assoc 157..276 CDD:286425 26/124 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452122
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.