Protein Alignment CG11367 and Xpnpep3

DIOPT Version :9

• Sequence 1: NP_649412.1
• Gene: CG11367 / 40491
• FlyBaseID: FBgn0037185
• Length: 362
• Species: Drosophila melanogaster
• Sequence 2: NP_001334004.1
• Gene: Xpnpep3 / 321003
• MGIID: 2445217
• Length: 506
• Species: Mus musculus
• Alignment Length: 47
• Identity: 15/47 - (31%)
• Similarity: 24/47 - (51%)
• Gaps: 6/47 - (12%)

  Fly   217 IRSCRHRIPVQRLIKNDTGRAILRV-ISG---PKAFRVVLFTRLTPI 259
            :||.:..|...||:|:.:  .|.|: |:|   .:||...:|....||
Mouse   233 VRSVQQLIQRLRLVKSPS--EIKRMQIAGKLTSEAFIETMFASKAPI 277

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
CG11367	NP_649412.1	DedA	150..340	CDD:223659	15/47 (32%)
		SNARE_assoc	180..298	CDD:286425	15/47 (32%)
Xpnpep3	NP_001334004.1	Interaction with TNFRSF1B. /evidence=ECO:0000250|UniProtKB:Q9NQH7	54..79

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0006
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900