DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and CG32454

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_730740.1 Gene:CG32454 / 318037 FlyBaseID:FBgn0260481 Length:534 Species:Drosophila melanogaster


Alignment Length:380 Identity:75/380 - (19%)
Similarity:109/380 - (28%) Gaps:166/380 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YSNNNDTNCIMQKPVPASTAPAFPQLIQASCSNAVEVDPPDSIVGAAGNSEALFAAQRTPDTSED 81
            |..::..:||:|:....:..|                         .||...:....||..||.:
  Fly   219 YDPSSPVSCIVQEVANEAKIP-------------------------MGNPRYILQYTRTVKTSRE 258

  Fly    82 SECDPFLASRRATRSSATT-----------------------SVLHNR---KRNSC--------- 111
                 ..|.|||..::|.:                       .:.|.|   .:.||         
  Fly   259 -----LRALRRANATAADSMAEVIAQHHQIPQELAASFDYKCRLRHARPDVTKTSCGLDGNGLWQ 318

  Fly   112 ------WGRAHSFLTRNW-YLGCLVP--ATILGALVFIGWATRDYARQLLFWIEMQNAWITFAVY 167
                  :|.....|.|.| ..|...|  ..|.|||:       |..|.|...|:          |
  Fly   319 MDAGCQYGGYEGGLARCWPSSGRFTPPQKMIYGALL-------DMRRDLCSLIQ----------Y 366

  Fly   168 MGLFALVSFPVVVGYFVLLITAGYLFGCLRGWVTVILGANI--------GIAVAHATIRSCR--H 222
            .|....|..|       |.:.|.||         ::|..::        |::.|..|:...|  :
  Fly   367 AGCEGAVRTP-------LELHAAYL---------ILLARHLRELRVLPKGVSSAAETVELARKYN 415

  Fly   223 RIPV----QRLIKNDTGRAILRVISGPKAFRVVLFTRLTPIPFGVQNVIF--------------- 268
            ..||    ..|.|.||.|                  ||...||...||:.               
  Fly   416 CSPVVVSHVGLGKRDTSR------------------RLLDYPFAPGNVMSLRLSISIPDDCCQAY 462

  Fly   269 ----GI-----SSINTR-DYHVATLIGLLPA--QTINVYLGSTLRSMHEVLSDND 311
                ||     .:::.| ||.|..|....|:  |.|.|.|.::....|.:.:|.|
  Fly   463 PEFRGILCQLGDTLHVRDDYSVDLLTAACPSEPQDIEVCLPASRTRSHRLRNDGD 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 43/203 (21%)
SNARE_assoc 180..298 CDD:286425 34/158 (22%)
CG32454NP_730740.1 Creatinase_N 106..223 CDD:304957 1/3 (33%)
APP_MetAP 259..468 CDD:294199 49/259 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.