DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and SPAC22G7.01c

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001342933.1 Gene:SPAC22G7.01c / 2541673 PomBaseID:SPAC22G7.01c Length:598 Species:Schizosaccharomyces pombe


Alignment Length:227 Identity:46/227 - (20%)
Similarity:70/227 - (30%) Gaps:78/227 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 TPDTSEDSECDP---FLASRRATRSSATTSVLHNRKRNSCWGRAHSFLTRNWYLGCLVPATILGA 136
            :|..:..:..||   :|....|.....||.|                 ||.|:.|  .|:.    
pombe   379 SPPATGSAIIDPTKIYLCDSGAQYKDGTTDV-----------------TRTWHFG--EPSE---- 420

  Fly   137 LVFIGWATRDYARQLLFWIEMQNAWITFAVYMGLFALVSFPV-VVGYFVLLITAGYLFGCLRGWV 200
                              .|.|.|.:....::.| |.:.||. ..||.:.::...||      | 
pombe   421 ------------------FERQTATLALKGHIAL-ANIVFPKGTTGYMIDVLARQYL------W- 459

  Fly   201 TVILGANIGIAVAHATIRSCR-----HRIPV---QRLIKNDTGRAILRVISGPKAFRVVLFTRLT 257
                  ..|:...|.|.....     |.:||   .|.:.|........|.|....|       ..
pombe   460 ------KYGLDYLHGTGHGVGSFLNVHELPVGIGSREVFNSAPLQAGMVTSNEPGF-------YE 511

  Fly   258 PIPFG--VQNVIFGISSINTRD-YHVATLIGL 286
            ...||  |:|.:: |:.:||.: :...|.:||
pombe   512 DGHFGYRVENCVY-ITEVNTENRFAGRTYLGL 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 33/149 (22%)
SNARE_assoc 180..298 CDD:286425 26/118 (22%)
SPAC22G7.01cNP_001342933.1 Creatinase_N 8..147 CDD:329087
Creatinase_N_2 154..307 CDD:318430
APP 310..534 CDD:238518 43/217 (20%)
Peptidase_M24_C 538..598 CDD:318429 3/5 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.