DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and Pepd

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_032846.2 Gene:Pepd / 18624 MGIID:97542 Length:493 Species:Mus musculus


Alignment Length:43 Identity:12/43 - (27%)
Similarity:17/43 - (39%) Gaps:5/43 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 VLLITAGYLFGCLRGWVTVILGANIGI-----AVAHATIRSCR 221
            :.|...|..:.|....:|....||...     |:..|.:||||
Mouse   272 ICLFDMGGEYYCFASDITCSFPANGKFTEDQKAIYEAVLRSCR 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 12/43 (28%)
SNARE_assoc 180..298 CDD:286425 12/43 (28%)
PepdNP_032846.2 AMP_N 23..138 CDD:282980
PepP 52..476 CDD:223085 12/43 (28%)
Prolidase 192..467 CDD:238520 12/43 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.