DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and pid-5

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_504162.2 Gene:pid-5 / 178819 WormBaseID:WBGene00021555 Length:1061 Species:Caenorhabditis elegans


Alignment Length:346 Identity:58/346 - (16%)
Similarity:101/346 - (29%) Gaps:145/346 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DTNCI--------MQKPVPASTAPAFPQLIQASCSNAVEVDPPDSIVGAAGNSEALFAAQRTPDT 78
            |.:||        .:.|:|....|:..:|::.                     .|.||::||...
 Worm   428 DRDCIGLCSTGDYFKVPIPEEPNPSHDKLVEL---------------------RARFASERTLGY 471

  Fly    79 SEDSECDPFLASRRATRSSATTSVLHNRKRNSCWGRAH------SFLTR----NWYLG--CLVPA 131
            ::              |:.....:|.|..       ||      .|.:|    |.|.|  .|...
 Worm   472 TD--------------RTPIAAYILPNTD-------AHQNELIPDFFSRVQFLNGYSGPSGLAII 515

  Fly   132 TILGALVFI---------------GWATRDY--ARQLLFWIEMQNAWITFAVYMGLFALVSF-PV 178
            |:..|:.::               .|..::|  ..:::.|:         |..:...:.|.| |.
 Worm   516 TLNEAMFWVDNGLLKSAESQVDDRSWTVKEYQSVEEVINWL---------AKILPPKSKVGFDPT 571

  Fly   179 VVGY--------------FVLLITAGYLFGCL-------RGWVTVILGANIGIAVAHATIRSCRH 222
            :|.|              |.|:...|.:...:       ||.|..:|..|......|        
 Worm   572 LVSYTWHQQALQSMTSDRFELVAIPGNIVDEIWRMRPFQRGDVVKMLDKNTPEIPVH-------- 628

  Fly   223 RIPVQRLIKN-DTGRAILRVISGPKAFRVVLFTRLTPIPFG------------------------ 262
             :.:.||.|: ...:.:..||:..:....:|..|...:|:.                        
 Worm   629 -VKIDRLRKSLKPNKCLAAVITSLEDIMWLLNIRGNDLPYNPVTYSYLFITMSDVRLFIDAKRLN 692

  Fly   263 -VQNVIFGISSINTRDYHVAT 282
             |....|...||:..||..|:
 Worm   693 DVSKAYFARQSIDVDDYKAAS 713

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 31/181 (17%)
SNARE_assoc 180..298 CDD:286425 26/150 (17%)
pid-5NP_504162.2 Creatinase_N 499..606 CDD:304957 19/115 (17%)
PepP 630..984 CDD:223085 15/84 (18%)
Creatinase_N_2 630..766 CDD:292807 15/84 (18%)
APP 772..996 CDD:238518
Peptidase_M24_C 998..1061 CDD:292806
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.