DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and K12C11.1

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_490843.1 Gene:K12C11.1 / 171704 WormBaseID:WBGene00019673 Length:498 Species:Caenorhabditis elegans


Alignment Length:112 Identity:25/112 - (22%)
Similarity:32/112 - (28%) Gaps:48/112 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NDTNCIMQKPVPASTAPAFPQL-------------IQASC------SNAVEVDP----------- 55
            :|....|....|.||.|....|             |:..|      .|....||           
 Worm   374 HDCGGYMGDATPRSTLPGLKSLRTTRTLMERMAITIEPGCYFIDFLLNEALADPKKSEFLVKSEI 438

  Fly    56 ------------PDSIVGAAGNSEALFAAQRTPDTSEDSECDPFLAS 90
                        .|.|:.|:|| |.|....||.:     |.:.|:||
 Worm   439 DKYRGSGGVRIEDDVIIRASGN-ENLSDLPRTVE-----EIENFMAS 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659
SNARE_assoc 180..298 CDD:286425
K12C11.1NP_490843.1 AMP_N 12..152 CDD:198079
Prolidase 189..465 CDD:238520 19/91 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.