powered by:
Protein Alignment CG11367 and K12C11.1
DIOPT Version :9
Sequence 1: | NP_649412.1 |
Gene: | CG11367 / 40491 |
FlyBaseID: | FBgn0037185 |
Length: | 362 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_490843.1 |
Gene: | K12C11.1 / 171704 |
WormBaseID: | WBGene00019673 |
Length: | 498 |
Species: | Caenorhabditis elegans |
Alignment Length: | 112 |
Identity: | 25/112 - (22%) |
Similarity: | 32/112 - (28%) |
Gaps: | 48/112 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 NDTNCIMQKPVPASTAPAFPQL-------------IQASC------SNAVEVDP----------- 55
:|....|....|.||.|....| |:..| .|....||
Worm 374 HDCGGYMGDATPRSTLPGLKSLRTTRTLMERMAITIEPGCYFIDFLLNEALADPKKSEFLVKSEI 438
Fly 56 ------------PDSIVGAAGNSEALFAAQRTPDTSEDSECDPFLAS 90
.|.|:.|:|| |.|....||.: |.:.|:||
Worm 439 DKYRGSGGVRIEDDVIIRASGN-ENLSDLPRTVE-----EIENFMAS 479
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0006 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.