DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11367 and Xpnpep1

DIOPT Version :9

Sequence 1:	NP_649412.1	Gene:	CG11367 / 40491	FlyBaseID:	FBgn0037185	Length:	362	Species:	Drosophila melanogaster
Sequence 2:	NP_573479.3	Gene:	Xpnpep1 / 170750	MGIID:	2180003	Length:	666	Species:	Mus musculus

Alignment Length:	128	Identity:	29/128 - (22%)
Similarity:	47/128 - (36%)	Gaps:	33/128 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly    11 NKTTYGYSNNNDTNCIMQKPVPASTAPAFPQLIQASCSNAVEVDPPDSIV---GAAGNSEALFAA 72
            |:.|.....:.:|:   .:..|..|:....||.||..::....:|..:.:   |.|..||.:
Mouse    28 NEVTPSGDKSVETD---HRMAPKVTSELLRQLRQAMRNSEYVAEPIQAYIIPSGDAHQSEYI--- 86

  Fly    73 QRTPDTSEDSECDPFLASRRATRS----SATTSVLHNRKRNSCWGRAHSFL------TRNWYL 125
                     :.||    .|||..|    ||.|::: ..:..:.|.....||      ..||.|
Mouse    87 ---------APCD----CRRAFVSGFDGSAGTAII-TEEHAAMWTDGRYFLQAAKQMDNNWTL 135

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11367	NP_649412.1	DedA	150..340	CDD:223659
CG11367	NP_649412.1	SNARE_assoc	180..298	CDD:286425
Xpnpep1	NP_573479.3	Creatinase_N	53..197	CDD:390097	24/100 (24%)
		Creatinase_N_2	200..369	CDD:379790
		APP	372..594	CDD:238518
		Peptidase_M24_C	600..661	CDD:379789
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0006
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900