DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and AgaP_AGAP000476

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_310616.4 Gene:AgaP_AGAP000476 / 1271763 VectorBaseID:AGAP000476 Length:653 Species:Anopheles gambiae


Alignment Length:322 Identity:64/322 - (19%)
Similarity:106/322 - (32%) Gaps:73/322 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VGAAGNSEALFAAQRTPDTSEDSECDPFLASRRATRSSATTSV-------LHNRKRNSCWGRAHS 117
            :|.|.|.:...|..|||     ...|..||..|:.....:...       .||.:..|...|...
Mosquito    25 LGRALNKDDELAEDRTP-----KSMDVILAEIRSLMRDYSIEAYIVPSVDAHNSEYISEHDRRLQ 84

  Fly   118 FLTRNWYLGCLVPATI-LGALVFIGWATRDY---------------ARQLLFWIEMQNAWITFAV 166
            ::|.  :.|....|.| ||....  |....|               .|:.|..:..::.|     
Mosquito    85 YVTN--FTGSAGTAIIMLGKAAL--WTDSRYHLQADGELDAAHWTLMREGLPGVPTRDEW----- 140

  Fly   167 YMGLFALVSFPVVVGYFVLLITA---GYLFGCL--RGWVTVILGAN-----------------IG 209
               |.|.:|...:||....||.:   |.|...|  ||:..:.|..|                 :.
Mosquito   141 ---LLANLSPGALVGTDPFLIASTEYGRLGAVLAQRGYRLIALERNLVDIVWNNRPPQTADELLP 202

  Fly   210 IAVAHATIRSCRHRIPVQRLIKNDTGRAILRVISGPKAFRVVLFTRLTPIPFGVQNVIFGISSIN 274
            :.:|::..|:......|:..::.....||  ::|.......:|..|.:.|.:  ..|.|....::
Mosquito   203 LPLAYSGRRAADKVQAVRVTLQEHGANAI--IVSALDEIAWLLNLRGSDILY--NPVFFAYLIVS 263

  Fly   275 TRDYHVATLIGLLPAQTINVYL------GSTLRSMHEVLSDNDTKLTGYISFLFEVICGVAL 330
            ....|:.|....:.| |:..:|      |..:|...::|...|..:.|....:....|..||
Mosquito   264 HTHLHLYTNADRINA-TVRAHLASEGVGGLEVRDYRDILPGIDEYVRGGNRLMVSTACSQAL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 40/209 (19%)
SNARE_assoc 180..298 CDD:286425 27/145 (19%)
AgaP_AGAP000476XP_310616.4 Creatinase_N_2 198..351 CDD:292807 24/132 (18%)
PepP 203..567 CDD:223085 24/127 (19%)
APP 354..573 CDD:238518
Peptidase_M24_C 587..648 CDD:292806
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.