DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and Xpnpep2

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_476496.1 Gene:Xpnpep2 / 117522 RGDID:621277 Length:674 Species:Rattus norvegicus


Alignment Length:168 Identity:37/168 - (22%)
Similarity:54/168 - (32%) Gaps:35/168 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NYKNKTTYGYSNNNDTNCIMQ------KPVPASTAPAFPQLIQASCSNAVEVD-----------P 55
            |.|.:.....|:..|...::|      |.||..|...|        |.|..:|           |
  Rat   358 NSKEQALLKASHVRDAVAVIQYLVWLEKNVPKGTVDEF--------SGAEHIDQLRRNENFSSGP 414

  Fly    56 PDSIVGAAGNSEALFAAQRTPDTSEDSECDP-FLASRRATRSSATTSVLHNRKRNSCWGRAHSFL 119
            ....:.|:|.:.||.....|.:.......|. :|..........||.:    .|...||...:| 
  Rat   415 SFETISASGLNAALAHYSPTKELHRKLSLDEMYLVDSGGQYWDGTTDI----TRTVHWGTPTAF- 474

  Fly   120 TRNWYLGCLVPATILGALVF----IGWATRDYARQLLF 153
            .:..|...|:....|..|||    .|.....:||:.|:
  Rat   475 QKEAYTRVLMGNIDLSRLVFPAATSGRVVEAFARRALW 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 1/4 (25%)
SNARE_assoc 180..298 CDD:286425
Xpnpep2NP_476496.1 Creatinase_N 53..177 CDD:307473
Creatinase_N_2 195..361 CDD:318430 1/2 (50%)
APP 365..583 CDD:238518 35/161 (22%)
Peptidase_M24_C 584..648 CDD:318429
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.