DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and tmem41a

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_004917844.1 Gene:tmem41a / 100492177 XenbaseID:XB-GENE-988524 Length:265 Species:Xenopus tropicalis


Alignment Length:157 Identity:38/157 - (24%)
Similarity:61/157 - (38%) Gaps:43/157 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 SFPVVVGYFVLLITAGYLFGCLRGWVTVIL-------GANIGIAVAHA------------TIRSC 220
            ||.:....|:.|: .|.|||   .|:.:.|       ||.....::||            .:.:.
 Frog    86 SFAIPGSSFLNLL-GGALFG---PWLGLFLCCTLTSIGATFCYLLSHAFGKKMVLMYFPDKVSTL 146

  Fly   221 RHRIPVQRLIKNDTGRAILRVISGPKAFRVVLFTRLTPI-PFGVQNVIFGISSINTRDYHVATLI 284
            ::::...|                ...|..:||.||.|: |....|:...|.:|....:..:.||
 Frog   147 QNKVEENR----------------SSLFFFLLFLRLFPMTPNWFLNLTSPILNIPVEQFFFSVLI 195

  Fly   285 GLLPAQTINVYLGSTL---RSMHEVLS 308
            ||||...|.|..||.|   :|:.::.|
 Frog   196 GLLPYNFICVQTGSILSQVKSLDDMFS 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 38/157 (24%)
SNARE_assoc 180..298 CDD:286425 31/137 (23%)
tmem41aXP_004917844.1 VTT 89..209 CDD:378149 31/139 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.