DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and tmem64

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_004915209.2 Gene:tmem64 / 100492114 XenbaseID:XB-GENE-6076037 Length:315 Species:Xenopus tropicalis


Alignment Length:251 Identity:86/251 - (34%)
Similarity:139/251 - (55%) Gaps:21/251 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 CWGRAHSFLTRNWYLGCLVPATILGALVFIGWATRDYARQLLFWIEMQNAWITFAVYMGLFALVS 175
            ||.|:...|       |.:.|....:|..    .|.|.:.:|.|:|..::.:...:::..|.|||
 Frog    57 CWCRSAVLL-------CALSAVCCASLAM----GRHYLKDVLLWLESLDSLVGMLLFIVGFILVS 110

  Fly   176 FPVVVGYFVLLITAGYLFGCLRGWVTVILGANIGIAVAHATIRSCRHRIPVQRLIKNDTGR---A 237
            .|.|.||.||.:.||||:|.:.|...|::|..||..:||..   |:..:....|.|..|..   |
 Frog   111 LPCVWGYIVLNVAAGYLYGLVLGIGLVVVGVLIGTFIAHLL---CKKLLTHWVLAKIHTSHKLGA 172

  Fly   238 ILRVISGPKAFRVVLFTRLTPIPFGVQNVIFGISSINTRDYHVATLIGLLPAQTINVYLGSTLRS 302
            ::||:.|....:||...||||||||:||.:|.|:.::..:|..|:.|||.|.|.:|.|||:|||:
 Frog   173 VIRVVEGGSGLKVVALARLTPIPFGLQNAVFSITDLSLPNYLAASSIGLFPTQLLNSYLGTTLRT 237

  Fly   303 MHEVLSDNDTKLTGYISFLFEVICGVALMFWVLQKARKELSETLLSA--DYNNEGK 356
            :.:|:::.  .::||..|..:||..:||||:|:.:|:.||:..:::.  ::...||
 Frog   238 IEDVIAEQ--SVSGYFIFSLQVIISIALMFYVVHRAQVELNAAIIACEMEFKTSGK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 73/192 (38%)
SNARE_assoc 180..298 CDD:286425 48/120 (40%)
tmem64XP_004915209.2 TVP38 63..233 CDD:223475 63/183 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I7989
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H45636
Inparanoid 1 1.050 148 1.000 Inparanoid score I4295
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1327131at2759
OrthoFinder 1 1.000 - - FOG0003179
OrthoInspector 1 1.000 - - oto103677
Panther 1 1.100 - - LDO PTHR46593
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5552
SonicParanoid 1 1.000 - - X5452
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.