DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11367 and Tmem64

DIOPT Version :9

Sequence 1:NP_649412.1 Gene:CG11367 / 40491 FlyBaseID:FBgn0037185 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_852066.2 Gene:Tmem64 / 100201 MGIID:2140359 Length:381 Species:Mus musculus


Alignment Length:240 Identity:84/240 - (35%)
Similarity:135/240 - (56%) Gaps:12/240 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 RNWYLGC---------LVPATILGALVFIGWA-TRDYARQLLFWIEMQNAWITFAVYMGLFALVS 175
            |||...|         ||...:|.||.|...| .|.|.:.||.|:|..::.:...:::..|.:||
Mouse   108 RNWRCCCLGSTCWCRSLVLVCVLAALCFASLALVRRYLQHLLLWVESLDSLLGVLLFVVGFIVVS 172

  Fly   176 FPVVVGYFVLLITAGYLFGCLRGWVTVILGANIGIAVAHATIRSCRHRIPVQRLIKNDTGRAILR 240
            ||...||.||.:.||||:|.:.|...:::|..||..:||...:.........|:..:|...|::|
Mouse   173 FPCGWGYIVLNVAAGYLYGFVLGMGLMVVGVLIGTFIAHVVCKRLLTAWVAARIQNSDKLSAVIR 237

  Fly   241 VISGPKAFRVVLFTRLTPIPFGVQNVIFGISSINTRDYHVATLIGLLPAQTINVYLGSTLRSMHE 305
            |:.|....:||...||||||||:||.:|.|:.:....|.:|:..||||.|.:|.|||:|||:|.:
Mouse   238 VVEGGSGLKVVALARLTPIPFGLQNAVFSITDVPLPSYLMASSAGLLPTQLLNSYLGTTLRTMED 302

  Fly   306 VLSDNDTKLTGYISFLFEVICGVALMFWVLQKARKELSETLLSAD 350
            |:::.  .|:||..|..:::..:.|||:|:.:|:.||:..:::.:
Mouse   303 VIAEQ--SLSGYFVFCLQIVISIGLMFYVVHRAQVELNAAIVACE 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11367NP_649412.1 DedA 150..340 CDD:223659 69/189 (37%)
SNARE_assoc 180..298 CDD:286425 45/117 (38%)
Tmem64NP_852066.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
TVP38 124..295 CDD:223475 63/170 (37%)
VTT domain. /evidence=ECO:0000250|UniProtKB:P36164 187..297 41/109 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831936
Domainoid 1 1.000 88 1.000 Domainoid score I7949
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H45636
Inparanoid 1 1.050 155 1.000 Inparanoid score I4297
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003179
OrthoInspector 1 1.000 - - oto93441
orthoMCL 1 0.900 - - OOG6_101862
Panther 1 1.100 - - LDO PTHR46593
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5552
SonicParanoid 1 1.000 - - X5452
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.880

Return to query results.
Submit another query.