DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14451 and C34H4.5

DIOPT Version :9

Sequence 1:NP_649410.1 Gene:CG14451 / 40488 FlyBaseID:FBgn0037183 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001367628.1 Gene:C34H4.5 / 176960 WormBaseID:WBGene00016427 Length:354 Species:Caenorhabditis elegans


Alignment Length:109 Identity:33/109 - (30%)
Similarity:45/109 - (41%) Gaps:25/109 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CEWCGKVY--KSLVRYHNHIVCTHKLP----VPDHQLV--NC--------FHCPRSDCRFHKHG- 69
            ||.||:.:  .|..|:|.  :..|..|    ..:.::|  ||        ||||.:.|...|.. 
 Worm    25 CEQCGREFMNSSACRFHQ--LKQHLKPDVSETNEKRIVQRNCVEPRIIMAFHCPDASCSSKKEWF 87

  Fly    70 PGVQNFRQIGRLRRHYQEKHMTGHLTCEYCQKQFQLKSALVAHR 113
            .|.:|      ||:||...|.....|||.|..:..|:..|..||
 Worm    88 DGQRN------LRQHYYRAHAEKKFTCEMCGYKVALEKDLNYHR 125



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D382234at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.