DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and GTS1

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_011334.1 Gene:GTS1 / 852694 SGDID:S000003149 Length:396 Species:Saccharomyces cerevisiae


Alignment Length:397 Identity:85/397 - (21%)
Similarity:141/397 - (35%) Gaps:82/397 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AQPANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNL-GVH----LTFVRSTNLDTNWTWLQLR 81
            ::.||| |.:|....|||.||..|:|:|..|::|||.: |..    .:.|:|.::| .||...:.
Yeast    24 SENANK-CGECGNFYPTWCSVNLGVFLCGRCASVHRKVFGSRDDDAFSNVKSLSMD-RWTREDID 86

  Fly    82 QM-QLGGNANAAQFFRAHNC-----STTDAQVKYNSRAAQLYRDK--LCAQAQQAMKTHGTKLHL 138
            :: .||||...|:|:...|.     ...|..:     .....|||  |.......:|.......:
Yeast    87 ELVSLGGNKGNARFWNPKNVPFPFDGDDDKAI-----VEHYIRDKYILGKFRYDEIKPEDFGSRM 146

  Fly   139 EQTD--------KSEGNEAAREEDFFAQCDNEVD-------FNVQNNNVSKQ----------DPN 178
            :..|        ::.....:|...|:....|..|       |....:..|:|          |.|
Yeast   147 DDFDGESDRFDERNRSRSRSRSHSFYKGGHNRSDYGGSRDSFQSSGSRYSRQLAELKDMGFGDTN 211

  Fly   179 PPTVAPVISVETQQGG--------APSVNLLNSVVPAAVPSSIGARKVQPKKGGLGARKVGGLGA 235
            ....|    :.:..|.        ..|.:..|||..||..|:       |......|...|...|
Yeast   212 KNLDA----LSSAHGNINRAIDYLEKSSSSRNSVSAAATTST-------PPLPRRRATTSGPQPA 265

  Fly   236 TKVKTNFADIEARANAANEMKTSAAAAPVVKPQTAEDELETVASMRLAYQE---LSMQKTREE-- 295
            ....||....:..:|:|:.::    |.|.|...|.:...:....|....|:   ::||:.:::  
Yeast   266 IFDGTNVITPDFTSNSASFVQ----AKPAVFDGTLQQYYDPATGMIYVDQQQYAMAMQQQQQQQQ 326

  Fly   296 --AKLKTMDPAKAKQMERLGMGFNLRGSDMAHSALGDMETIQQSAAPKAKLSLLESENFFTDFSL 358
              |..:....|:|:...::......:....|.:....|:.:|.....:|.||       |...|.
Yeast   327 QLAVAQAQAQAQAQAQAQVQAQAQAQAQAQAQAQQIQMQQLQMQQQQQAPLS-------FQQMSQ 384

  Fly   359 YGNSSSG 365
            .||...|
Yeast   385 GGNLPQG 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 34/111 (31%)
GTS1NP_011334.1 COG5347 8..310 CDD:227651 68/307 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.