DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and AGE1

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_010812.3 Gene:AGE1 / 852136 SGDID:S000002932 Length:482 Species:Saccharomyces cerevisiae


Alignment Length:154 Identity:42/154 - (27%)
Similarity:71/154 - (46%) Gaps:26/154 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AAGPSKQEIESVFSRLRAQPANKSCFDCAAKAPT-WSSVTYGIFICIDCSAVHRNLGVHLTFVRS 68
            |...::.|:.|:..::  ..:|..|.||.:.|.. |.|:.....:||.||.|||:||.|::.:||
Yeast   164 AGASNRDELLSIVRKI--DKSNLKCCDCGSTATVEWVSINLLCILCIKCSGVHRSLGSHISKIRS 226

  Fly    69 TNLDTNWTWLQLRQMQLGGNANAAQFFRAHNCSTTDAQVKYNSRAAQLYRDKLCAQAQQAMKTHG 133
            ..|| |:|.|:|  |.|..|          |.|.::....|.|........|:.|.:..:.:   
Yeast   227 LTLD-NFTSLEL--MHLLQN----------NVSNSNVNAIYESNLRNFPVKKITANSDDSER--- 275

  Fly   134 TKLHLEQ-------TDKSEGNEAA 150
            :|..:::       .|.::|.||:
Yeast   276 SKFIIDKYQFKKFVIDSNQGREAS 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 32/104 (31%)
AGE1NP_010812.3 COG5347 164..480 CDD:227651 42/154 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.