DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and GCS1

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_010055.1 Gene:GCS1 / 851372 SGDID:S000002385 Length:352 Species:Saccharomyces cerevisiae


Alignment Length:327 Identity:83/327 - (25%)
Similarity:128/327 - (39%) Gaps:111/327 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTFVRSTNLDTNWTWLQLRQMQLGGNA 89
            |||.|.||.|..|.|::..:|.|||::|:.:||.||||::||||..:| .:...:|.:|:.|||.
Yeast    22 ANKKCMDCGAPNPQWATPKFGAFICLECAGIHRGLGVHISFVRSITMD-QFKPEELLRMEKGGNE 85

  Fly    90 NAAQFFRAHNCSTTDAQ-VKYNSRAAQLYRDKLCAQAQQ-------------------------- 127
            ...::|::||...:..| |||::..|:.|::||....:.                          
Yeast    86 PLTEWFKSHNIDLSLPQKVKYDNPVAEDYKEKLTCLCEDRVFEEREHLDFDASKLSATSQTAASA 150

  Fly   128 ----AMKTHGTKLHLEQT----DKSEGNEAARE--EDFFAQCDNEVDFNVQNNNVSKQDPNPPTV 182
                |....||.|...::    :.|.|....:|  |.:||:        :...|.|:.|..||: 
Yeast   151 TPGVAQSREGTPLENRRSATPANSSNGANFQKEKNEAYFAE--------LGKKNQSRPDHLPPS- 206

  Fly   183 APVISVETQQGG-----------------APSVNLLNSVVPAAVPSSIGARKVQPKKGGLGARKV 230
                     |||                 |.|.|.|          |:...:..|    ||....
Yeast   207 ---------QGGKYQGFGSTPAKPPQERSAGSSNTL----------SLENFQADP----LGTLSR 248

  Fly   231 G-GLGATKVKTNFADIEARANAANEMKTSAAAAPVVKP--------QTAEDELETVASMRLAYQE 286
            | ||.::.|..:|.|:       ||        .|:||        :.:|:.....|.....:||
Yeast   249 GWGLFSSAVTKSFEDV-------NE--------TVIKPHVQQWQSGELSEETKRAAAQFGQKFQE 298

  Fly   287 LS 288
            .|
Yeast   299 TS 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 39/96 (41%)
GCS1NP_010055.1 COG5347 4..350 CDD:227651 83/327 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45686
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.