DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and Appl1

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_660256.1 Gene:Appl1 / 72993 MGIID:1920243 Length:707 Species:Mus musculus


Alignment Length:526 Identity:96/526 - (18%)
Similarity:167/526 - (31%) Gaps:187/526 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LQLRQM-QLGGNANAAQFFRAHNCS------------TTDAQVKYNSRAAQ-------------- 115
            |.|::: |:..|.:.|...|....|            |.|.   |.||..|              
Mouse   127 LTLKEVFQIASNDHDAAINRYSRLSKKRENDKVKYEVTEDV---YTSRKKQHQTMMHYFCALNTL 188

  Fly   116 LYRDKLC--------AQAQQAMKTHGTKLHLEQTDKSEGNEAAREEDFFAQCDNEV--------D 164
            .|:.|:.        .|||.:....|::....|.::...|.....::...:.|.:|        |
Mouse   189 QYKKKIALLEPLLGYMQAQISFFKMGSENLNGQLEEFLANIGTSVQNVRREMDGDVETMQQTIED 253

  Fly   165 FNVQNNNVSKQDPNPPTVAPVISVETQQGGAPSVNLLNSVVPAAVPSSIGARKVQPKKGG---LG 226
            ..|.::.:...||: ||..|:....|::.|     .||:.....:.||...|:....:||   ..
Mouse   254 LEVASDPLYLPDPD-PTKFPINRNLTRKAG-----YLNARNKTGLVSSTWDRQFYFTQGGNLMSQ 312

  Fly   227 AR--KVGGLG--ATKVKTNFADIEARANAANEMKTSAAAAPVVKPQTAEDELETVASMRLAYQEL 287
            ||  ..|||.  .........|.|.|.............:.:::.::.:|..|.:.::....:::
Mouse   313 ARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGKKSSILQAESKKDHEEWICTINNISKQI 377

  Fly   288 SMQKTREEAKLK---------TMDPAKAKQMERLGMGFNLRGSDMAHSALGDMETIQQSAAPKAK 343
            .:.:..||...:         |..|:..::.|.|..|                   .||..|.|:
Mouse   378 YLSENPEETAARVNQSALEAVTPSPSFQQRHESLRPG-------------------GQSRPPTAR 423

  Fly   344 LSLLESENFFTDFSLYGNSSSGGGGGGSSEKRESSVGGTSKLDKFELDAL-------GYETIEPI 401
                             .||||..|..|           :.|....||:|       .::.|.|:
Mouse   424 -----------------TSSSGSLGSES-----------TNLAALSLDSLVAPDTPIQFDIISPV 460

  Fly   402 GGSHSNITSMFSRSNDYDKPKTSAPVKKNSGSSQTHTKGGTSTDPVIAQQKFGNSKGFGSDQYFA 466
                           ..|:|          |.::...:||..|:|      ||.|.|        
Mouse   461 ---------------CEDQP----------GQAKAFGQGGRRTNP------FGESGG-------- 486

  Fly   467 SEQSSADVS----ASLNRFQGSRAISSSDYFGDGSPGGTGGNRASSVNFSAPDLDVESVKESV-R 526
            |.:|..:.|    ..:.||.||..:.|.|:                     ||:..|::::.: .
Mouse   487 STKSETEDSILHQLFIVRFLGSMEVKSDDH---------------------PDVVYETMRQILAA 530

  Fly   527 QGVHKV 532
            :.:|.:
Mouse   531 RAIHNI 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 14/69 (20%)
Appl1NP_660256.1 Required for RAB5A binding. /evidence=ECO:0000250 1..428 62/345 (18%)
BAR_APPL1 20..234 CDD:153315 21/109 (19%)
BAR-PH_APPL 252..376 CDD:270067 26/129 (20%)
PH 280..375 CDD:278594 18/99 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..433 14/71 (20%)
F&H. /evidence=ECO:0000250 403..414 2/10 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 466..490 10/37 (27%)
PTB_APPL 489..624 CDD:269980 12/69 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 636..707
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.