DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and AGAP5

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001137472.1 Gene:AGAP5 / 729092 HGNCID:23467 Length:686 Species:Homo sapiens


Alignment Length:188 Identity:50/188 - (26%)
Similarity:77/188 - (40%) Gaps:44/188 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASPAAGPSKQEIESVFSRLRAQP-----ANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLG 60
            :.|..:..||.::.|....:..|.     .|..|.|...:.|.|:|:..|:.:||:||.:||:||
Human   446 LQSCESSKSKSQLTSQSEAMALQSIQNMRGNAHCVDYETQNPKWASLNLGVLMCIECSGIHRSLG 510

  Fly    61 VHLTFVRSTNLDTNWTWLQLRQ-MQLGGNANAAQFFRAHNCSTTDAQVKYNSRAAQ-----LYRD 119
            ..|:.|||..|| :|. ::||: |...||..|...:...:...|...||......:     .|.:
Human   511 TRLSRVRSLELD-DWP-VELRKVMSSIGNDLANSIWEGSSQGQTKPSVKSTREEKERWIRSKYEE 573

  Fly   120 KL------C-----------AQAQQAMKT------HGTKLHLEQTDKSEGNEAAREED 154
            ||      |           |.|.:.::|      ||:        :.|.||...|.|
Human   574 KLFLAPLPCTELSLGQHLLRATADEDLQTAILLLAHGS--------REEVNETCGEGD 623

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 33/114 (29%)
AGAP5NP_001137472.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 205..242
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..278