DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and Smap2

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_598477.2 Gene:Smap2 / 69780 MGIID:1917030 Length:428 Species:Mus musculus


Alignment Length:247 Identity:74/247 - (29%)
Similarity:112/247 - (45%) Gaps:36/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GPSKQEI---ESVFSRLRAQPANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTFVRS 68
            |.|.:::   ::|.:.|..:..||.|.||.:|.|.|:|...|:||||.|:.:|||||||::.|:|
Mouse     3 GKSVKDVDRYQAVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKS 67

  Fly    69 TNLDTNWTWLQLRQMQLGGNANAAQFFRAHNCSTTDAQVKYNSRAAQLYRDKLCAQAQQAMKTHG 133
            .||| .||..|::.||..||..|.:.:.|: ...|..:.:.:.......|||...:.........
Mouse    68 VNLD-QWTQEQIQCMQEMGNGKANRLYEAY-LPETFRRPQIDPAVEGFIRDKYEKKKYMDRSLDI 130

  Fly   134 TKLHLEQTDK-SEGNEAAREEDFFAQCDNEVDFNVQNNNVSKQD------PNPPTVAPVISV--- 188
            ..|..|:.|| ..|||.|.|:..     ..|.|........|:|      .:|.:.|||:.:   
Mouse   131 NVLRKEKDDKWKRGNEPAPEKKM-----EPVVFEKVKMPQKKEDAQLPRKSSPKSAAPVMDLLGL 190

  Fly   189 -----------ETQQGGAPSVNLLNSVVPAAVPSSIGARKV--QPKKGGLGA 227
                       :|.......::||.| ||:  |||:..:.|  .|..|..|:
Mouse   191 DAPVACSIANSKTSNALEKDLDLLAS-VPS--PSSVSRKAVGSMPTAGSAGS 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 40/103 (39%)
Smap2NP_598477.2 ArfGap 13..126 CDD:307528 42/114 (37%)
Interaction with clathrin heavy chains 163..231 16/70 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..262 8/24 (33%)
Med15 276..>416 CDD:312941
Interaction with PICALM. /evidence=ECO:0000269|PubMed:16571680 339..428
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.