DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and Acap2

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:XP_017453554.1 Gene:Acap2 / 619382 RGDID:1562939 Length:816 Species:Rattus norvegicus


Alignment Length:258 Identity:60/258 - (23%)
Similarity:112/258 - (43%) Gaps:54/258 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASPAAG------PSKQEI---ESVFSRLRAQPANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHR 57
            :||:.|      .||:::   ||...|::..|.|.||.||....|.|:|:..||.:||:||.:||
  Rat   389 SSPSTGSLDSGSESKEKLLKGESALQRVQCIPGNTSCCDCGLADPRWASINLGITLCIECSGIHR 453

  Fly    58 NLGVHLTFVRSTNLDTNWTW--------------------------LQLRQMQLGGNANAAQFFR 96
            :||||.:.|||..||   ||                          :.:::.|.|.......:.|
  Rat   454 SLGVHFSKVRSLTLD---TWEPELLKLMCELGNDVINRVYEAKLEKMGVKKPQPGQRQEKEAYIR 515

  Fly    97 AHNCSTTDAQVKYNSRAAQLYRDK-LCAQAQQAMKTHGTKLHLEQTDKSEGNEAAREEDFFAQCD 160
            |......... ||::..:...::| :.:::.:..:...|::.:.....:..::.||.|..|  |.
  Rat   516 AKYVERKFVD-KYSTLLSPSEQEKRIISKSCEDQRLSHTRVSVHTPVAAVNSDEARRESLF--CP 577

  Fly   161 NEVDFNVQNNNVSKQDPNPPTVAPVISVETQQGGAPSVNLLNSVVPAAVPSSIGARKVQPKKG 223
            :|:|     :..|..|    |.:.:.|:::...|   :...:.....::||::.|..:...:|
  Rat   578 DELD-----SLFSYFD----TSSKLRSIKSNDSG---IQQCSDDGRESLPSTVSANSLYEPEG 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 36/130 (28%)
Acap2XP_017453554.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.