DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and ARFGAP1

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:XP_011527203.1 Gene:ARFGAP1 / 55738 HGNCID:15852 Length:416 Species:Homo sapiens


Alignment Length:553 Identity:135/553 - (24%)
Similarity:195/553 - (35%) Gaps:200/553 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASPAAGPSKQEIESVFSRLRAQPANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTF 65
            ||||       ....|...:|.|..|..||:|.|..|.|.||||||:||::||..||.|||||:|
Human     1 MASP-------RTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSF 58

  Fly    66 VRSTNLDTNWTWLQLRQMQLGGNANAAQFFRAHN----CSTTDAQVKYNSRAAQLYRDKLCAQAQ 126
            |||..:| .|..::|.:|:.||||...:|..:..    |  ...|.|||||||.|:|||:.|.| 
Human    59 VRSVTMD-KWKDIELEKMKAGGNAKFREFLESQEDYDPC--WSLQEKYNSRAAALFRDKVVALA- 119

  Fly   127 QAMKTHGTKLHLEQTDKSEGNEAAREEDFFAQCDNEVDFNVQNNNVSKQDPNPPTVAPVISVETQ 191
                              ||.|                ::::::......|..|...|  |:..:
Human   120 ------------------EGRE----------------WSLESSPAQNWTPPQPRTLP--SMVHR 148

  Fly   192 QGGAPSVNLLNSVVPAA-------VPSSIGARKVQPKKGGLGARKVGGLGATKVKTNFADIEARA 249
            ..|.|     .||..::       :...:|:     .:|..|.|.| |.|.|.            
Human   149 VSGQP-----QSVTASSDKAFEDWLNDDLGS-----YQGAQGNRYV-GFGNTP------------ 190

  Fly   250 NAANEMKTSAAAAPVVKPQTAEDEL--ETVASMRLAYQELSMQKTREEAKLKTMDPAKAKQMERL 312
                            .||..||:.  ..::|:...:...:...:|..:..|........|..:.
Human   191 ----------------PPQKKEDDFLNNAMSSLYSGWSSFTTGASRFASAAKEGATKFGSQASQK 239

  Fly   313 GMGFNLR---GSDMAHSALGDMETIQQSAAPKAKLSLLESENFFTDFSLYGNSSSGGG------- 367
            ..|...:   .|::.||.   .|.:.:.|..|.|           :..::.:.|||..       
Human   240 FWGHKQQPEPASELGHSL---NENVLKPAQEKVK-----------EGKIFDDVSSGVSQLASKVQ 290

  Fly   368 GGGS----------SEKRESSVGGTSK--------LDKFELDALGYETIEPIGGSHSNITSMFSR 414
            |.||          |.|.|..:...|:        ||.|:               :|||...|  
Human   291 GVGSKGWRDVTTFFSGKAEGPLDSPSEGHSYQNSGLDHFQ---------------NSNIDQSF-- 338

  Fly   415 SNDYDKPKTSAPVK-KNSGSSQTHTKGGTSTDPVIAQQKFGNSKGFGSDQYFASEQSSADV---- 474
               ::...::.|.| :.|.||.:.|...|||                       |:.|:|.    
Human   339 ---WETFGSAEPTKTRKSPSSDSWTCADTST-----------------------ERRSSDSWEVW 377

  Fly   475 -SASLNRFQGSRAISSSDYFGDGSPGGTGGNRA 506
             |||.||...|          ||..||.|..:|
Human   378 GSASTNRNSNS----------DGGEGGEGTKKA 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 51/107 (48%)
ARFGAP1XP_011527203.1 ArfGap 7..114 CDD:279720 51/109 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1155557at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.